| Product Number |
ARP55889_P050 |
| Product Page |
www.avivasysbio.com/nhlrc2-antibody-n-terminal-region-arp55889-p050.html |
| Name |
NHLRC2 Antibody - N-terminal region (ARP55889_P050) |
| Protein Size (# AA) |
726 amino acids |
| Molecular Weight |
79kDa |
| NCBI Gene Id |
374354 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
NHL repeat containing 2 |
| Alias Symbols |
FINCA |
| Peptide Sequence |
Synthetic peptide located within the following region: YSDKDGLLIIGVHSAKFPNEKVLDNIKSAVLRYNITHPMVNDADASLWQE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kimura,K., (2006) Genome Res. 16 (1), 55-65 |
| Description of Target |
The specific function of this protein remains unknown. |
| Protein Interactions |
CEP76; ATG3; DAK; TNFAIP8; ACOT7; DPP3; PEPD; ASS1; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NHLRC2 (ARP55889_P050) antibody |
| Blocking Peptide |
For anti-NHLRC2 (ARP55889_P050) antibody is Catalog # AAP55889 (Previous Catalog # AAPP37118) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NHLRC2 |
| Uniprot ID |
Q8NBF2 |
| Protein Name |
NHL repeat-containing protein 2 |
| Protein Accession # |
NP_940916 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_198514 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NHLRC2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Human Testis
 | Rabbit Anti-NHLRC2 antibody
Catalog Number: ARP55889
Formalin Fixed Paraffin Embedded Tissue: Human Testis
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec |
| | Image 2 | Human 721_B
 | WB Suggested Anti-NHLRC2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate |
|
|
