C11orf53 Antibody - middle region (ARP55885_P050)

Data Sheet
 
Product Number ARP55885_P050
Product Page www.avivasysbio.com/c11orf53-antibody-middle-region-arp55885-p050.html
Name C11orf53 Antibody - middle region (ARP55885_P050)
Protein Size (# AA) 236 amino acids
Molecular Weight 25kDa
NCBI Gene Id 341032
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Chromosome 11 open reading frame 53
Alias Symbols MGC50104
Peptide Sequence Synthetic peptide located within the following region: SIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
Description of Target The specific function of this protein remains unknown.
Protein Interactions SMYD1; APP;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-C11orf53 (ARP55885_P050) antibody
Blocking Peptide For anti-C11orf53 (ARP55885_P050) antibody is Catalog # AAP55885 (Previous Catalog # AAPP37114)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human C11orf53
Uniprot ID Q8IXP5
Protein Name Uncharacterized protein C11orf53
Protein Accession # NP_940900
Purification Affinity Purified
Nucleotide Accession # NM_198498
Tested Species Reactivity Human
Gene Symbol C11orf53
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 100%
Image 1
Human HeLa
WB Suggested Anti-C11orf53 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com