| Product Number |
ARP55881_P050 |
| Product Page |
www.avivasysbio.com/fam92b-antibody-n-terminal-region-arp55881-p050.html |
| Name |
FAM92B Antibody - N-terminal region (ARP55881_P050) |
| Protein Size (# AA) |
304 amino acids |
| Molecular Weight |
35kDa |
| NCBI Gene Id |
339145 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Family with sequence similarity 92, member B |
| Alias Symbols |
FAM92B |
| Peptide Sequence |
Synthetic peptide located within the following region: FAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
The specific function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FAM92B (ARP55881_P050) antibody |
| Blocking Peptide |
For anti-FAM92B (ARP55881_P050) antibody is Catalog # AAP55881 (Previous Catalog # AAPP37110) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FAM92B |
| Uniprot ID |
Q6ZTR7 |
| Protein Name |
Protein FAM92B |
| Protein Accession # |
NP_940893 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_198491 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FAM92B |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100% |
| Image 1 | Human HeLa
 | WB Suggested Anti-FAM92B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate |
|
|
