MAT2B Antibody - N-terminal region (ARP55849_P050)

Data Sheet
 
Product Number ARP55849_P050
Product Page www.avivasysbio.com/mat2b-antibody-n-terminal-region-arp55849-p050.html
Name MAT2B Antibody - N-terminal region (ARP55849_P050)
Protein Size (# AA) 323 amino acids
Molecular Weight 36kDa
Subunit beta
NCBI Gene Id 27430
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Methionine adenosyltransferase II, beta
Alias Symbols TGR, MAT-II, SDR23E1, MATIIbeta, Nbla02999
Peptide Sequence Synthetic peptide located within the following region: KEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ramani,K., (2008) Hepatology 47 (2), 521-531
Description of Target MAT2B belongs to the methionine adenosyltransferase (MAT) family. MAT catalyzes the biosynthesis of S-adenosylmethionine from methionine and ATP. This protein is the regulatory beta subunit of MAT.The protein encoded by this gene belongs to the methionine adenosyltransferase (MAT) family. MAT catalyzes the biosynthesis of S-adenosylmethionine from methionine and ATP. This protein is the regulatory beta subunit of MAT. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
Protein Interactions TRIM27; MAT2A; KPNA4; KPNA3; SUMO2; FERMT2; YWHAQ; ATG7; PDIA6; STK24; TUBA1A; EIF4H; UGDH; SNX1; PPP3CA; PPP1CA; PFAS; NASP; GLA; GAPDH; G6PD; EIF5; DFFA; CNN2; XPO5; CAPNS1; TUBB; P3H1; FBXO25; BAG3; UBC; TNS3; APP; ELAVL1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MAT2B (ARP55849_P050) antibody
Blocking Peptide For anti-MAT2B (ARP55849_P050) antibody is Catalog # AAP55849 (Previous Catalog # AAPP35536)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MAT2B
Uniprot ID A8K7A4
Protein Name cDNA FLJ76904, highly similar to Homo sapiens methionine adenosyltransferase II, beta (MAT2B), transcript variant 2, mRNA EMBL BAF84608.1
Protein Accession # NP_877725
Purification Affinity Purified
Nucleotide Accession # NM_182796
Tested Species Reactivity Human
Gene Symbol MAT2B
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Liver
WB Suggested Anti-MAT2B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com