| Product Number |
ARP55842_P050 |
| Product Page |
https://www.avivasysbio.com/wdr53-antibody-middle-region-arp55842-p050.html |
| Name |
WDR53 Antibody - middle region (ARP55842_P050) |
| Protein Size (# AA) |
358 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
348793 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
WD repeat domain 53 |
| Alias Symbols |
MGC64882 |
| Peptide Sequence |
Synthetic peptide located within the following region: NLLASADDSGAIKILDLENKKVIRSLKRHSNICSSVAFRPQRPQSLVSCG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Higa,L.A., (2006) Nat. Cell Biol. 8 (11), 1277-1283 |
| Description of Target |
The specific function of this protein remains unknown. |
| Protein Interactions |
WDR5; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-WDR53 (ARP55842_P050) antibody |
| Blocking Peptide |
For anti-WDR53 (ARP55842_P050) antibody is Catalog # AAP55842 (Previous Catalog # AAPP37015) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human WDR53 |
| Uniprot ID |
Q7Z5U6 |
| Protein Name |
WD repeat-containing protein 53 |
| Protein Accession # |
NP_872433 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_182627 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
WDR53 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%; Zebrafish: 85% |
| Image 1 | Human Brain
 | WB Suggested Anti-WDR53 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain |
|
|
