| Product Number |
ARP55801_P050 |
| Product Page |
www.avivasysbio.com/efha2-antibody-n-terminal-region-arp55801-p050.html |
| Name |
EFHA2 Antibody - N-terminal region (ARP55801_P050) |
| Protein Size (# AA) |
530 amino acids |
| Molecular Weight |
61kDa |
| NCBI Gene Id |
286097 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
EF-hand domain family, member A2 |
| Alias Symbols |
EFHA2 |
| Peptide Sequence |
Synthetic peptide located within the following region: TLGLPGRPFSSREDEERAVAEAAWRRRRRWGELSVAAAAGGGLVGLVCYQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004) |
| Description of Target |
The specific function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MICU3 (ARP55801_P050) antibody |
| Blocking Peptide |
For anti-MICU3 (ARP55801_P050) antibody is Catalog # AAP55801 (Previous Catalog # AAPP36824) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human EFHA2 |
| Uniprot ID |
Q86XE3 |
| Protein Name |
EF-hand domain-containing family member A2 |
| Protein Accession # |
NP_859074 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_181723 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MICU3 |
| Predicted Species Reactivity |
Human, Cow, Dog, Horse, Pig, Rabbit, Yeast |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 75%; Dog: 75%; Horse: 83%; Human: 100%; Pig: 83%; Rabbit: 93%; Yeast: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-EFHA2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
|
|
