| Product Number |
ARP55794_P050 |
| Product Page |
www.avivasysbio.com/eras-antibody-middle-region-arp55794-p050.html |
| Name |
ERAS Antibody - middle region (ARP55794_P050) |
| Protein Size (# AA) |
233 amino acids |
| Molecular Weight |
25kDa |
| NCBI Gene Id |
3266 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ES cell expressed Ras |
| Description |
|
| Alias Symbols |
HRAS2, HRASP |
| Peptide Sequence |
Synthetic peptide located within the following region: AQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Miyamoto,S., (2008) Carcinogenesis 29 (2), 418-426 |
| Description of Target |
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. ERAS plays an important role in the tumor-like growth properties of embryonic stem cells. |
| Protein Interactions |
PIK3CD; PIK3R1; RAF1; PIK3CG; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ERAS (ARP55794_P050) antibody |
| Blocking Peptide |
For anti-ERAS (ARP55794_P050) antibody is Catalog # AAP55794 (Previous Catalog # AAPP36817) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ERAS |
| Uniprot ID |
Q7Z444 |
| Protein Name |
GTPase ERas |
| Publications |
The whole-genome expression analysis of peripheral blood mononuclear cells from aspirin sensitive asthmatics versus aspirin tolerant patients and healthy donors after in vitro aspirin challenge. Respir Res. 16, 147 (2015). 26646719 |
| Protein Accession # |
NP_853510 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_181532 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ERAS |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 85%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 86% |
| Image 1 | Human Lung
 | WB Suggested Anti-ERAS Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung |
|
