| Product Number |
ARP55751_P050 |
| Product Page |
https://www.avivasysbio.com/ildr1-antibody-middle-region-arp55751-p050.html |
| Name |
ILDR1 Antibody - middle region (ARP55751_P050) |
| Protein Size (# AA) |
502 amino acids |
| Molecular Weight |
58kDa |
| NCBI Gene Id |
286676 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Immunoglobulin-like domain containing receptor 1 |
| Alias Symbols |
DFNB42, ILDR1beta, ILDR1alpha, ILDR1alpha' |
| Peptide Sequence |
Synthetic peptide located within the following region: RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hauge,H., (2004) Biochem. Biophys. Res. Commun. 323 (3), 970-978 |
| Description of Target |
ILDR1 is a putative membrane receptor. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ILDR1 (ARP55751_P050) antibody |
| Blocking Peptide |
For anti-ILDR1 (ARP55751_P050) antibody is Catalog # AAP55751 (Previous Catalog # AAPP36616) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ILDR1 |
| Uniprot ID |
Q86SU0-2 |
| Protein Name |
Immunoglobulin-like domain-containing receptor 1 |
| Protein Accession # |
NP_787120 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_175924 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ILDR1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Rat: 79% |
| Image 1 | Human Brain
 | WB Suggested Anti-ILDR1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain |
|
|
