| Product Number |
ARP55734_P050-Biotin |
| Product Page |
www.avivasysbio.com/sec14l4-antibody-n-terminal-region-biotin-arp55734-p050-biotin.html |
| Name |
SEC14L4 Antibody - N-terminal region : Biotin (ARP55734_P050-Biotin) |
| Protein Size (# AA) |
406 amino acids |
| Molecular Weight |
47kDa |
| Conjugation |
Biotin |
| NCBI Gene Id |
284904 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
SEC14-like 4 (S. cerevisiae) |
| Alias Symbols |
TAP3 |
| Peptide Sequence |
Synthetic peptide located within the following region: MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Mokashi,V., (2004) Biochem. Biophys. Res. Commun. 316 (3), 688-692 |
| Description of Target |
SEC14L4 is a probable hydrophobic ligand-binding protein; may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids.The protein encoded by this gene is highly similar to the protein encoded by the Saccharomyces cerevisiae SEC14 gene. The SEC14 protein is a phophatidylinositol transfer protein that is essential for biogenesis of Golgi-derived transport vesicles, and thus is required for the export of yeast secretory proteins from the Golgi complex. The specific function of this protein has not yet been determined. |
| Protein Interactions |
INCA1; BMF; USHBP1; TCF4; REL; ELAVL1; UBC; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-SEC14L4 (ARP55734_P050-Biotin) antibody |
| Blocking Peptide |
For anti-SEC14L4 (ARP55734_P050-Biotin) antibody is Catalog # AAP55734 (Previous Catalog # AAPP36441) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SEC14L4 |
| Uniprot ID |
Q9UDX3 |
| Protein Name |
SEC14-like protein 4 |
| Sample Type Confirmation |
SEC14L4 is supported by BioGPS gene expression data to be expressed in OVCAR3 |
| Protein Accession # |
NP_777637 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_174977 |
| Gene Symbol |
SEC14L4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100% |
| Image 1 | |
|
