NEGR1 Antibody - N-terminal region (ARP55701_P050)

Data Sheet
 
Product Number ARP55701_P050
Product Page www.avivasysbio.com/negr1-antibody-n-terminal-region-arp55701-p050.html
Name NEGR1 Antibody - N-terminal region (ARP55701_P050)
Protein Size (# AA) 354 amino acids
Molecular Weight 39kDa
NCBI Gene Id 257194
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Neuronal growth regulator 1
Alias Symbols Ntra, KILON, IGLON4, DMML2433
Peptide Sequence Synthetic peptide located within the following region: WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target NEGR1 may be involved in cell-adhesion. NEGR1 may function as a trans-neural growth-promoting factor in regenerative axon sprouting in the mammalian brain.
Protein Interactions NEGR1; NTM; LSAMP; Htt;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NEGR1 (ARP55701_P050) antibody
Blocking Peptide For anti-NEGR1 (ARP55701_P050) antibody is Catalog # AAP55701 (Previous Catalog # AAPP44438)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NEGR1
Uniprot ID Q7Z3B1
Protein Name Neuronal growth regulator 1
Protein Accession # NP_776169
Purification Affinity Purified
Nucleotide Accession # NM_173808
Tested Species Reactivity Human
Gene Symbol NEGR1
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-NEGR1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com