| Product Number |
ARP55695_P050 |
| Product Page |
https://www.avivasysbio.com/mpv17l-antibody-n-terminal-region-arp55695-p050.html |
| Name |
MPV17L Antibody - N-terminal region (ARP55695_P050) |
| Protein Size (# AA) |
196 amino acids |
| Molecular Weight |
17kDa |
| NCBI Gene Id |
255027 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
MPV17 mitochondrial membrane protein-like |
| Alias Symbols |
M-LPH, MLPH1, MLPH2, MPV17L1 |
| Peptide Sequence |
Synthetic peptide located within the following region: MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Iida,R., (2006) Biochem. Biophys. Res. Commun. 344 (3), 948-954 |
| Description of Target |
Isoform 1 participates in reactive oxygen species metablism by up- or down-regulation of the genes of antioxidant enzymes. |
| Protein Interactions |
APP; ELAVL1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MPV17L (ARP55695_P050) antibody |
| Blocking Peptide |
For anti-MPV17L (ARP55695_P050) antibody is Catalog # AAP55695 (Previous Catalog # AAPP36143) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MPV17L |
| Uniprot ID |
Q2QL34 |
| Protein Name |
Mpv17-like protein |
| Protein Accession # |
NP_776164 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_173803 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MPV17L |
| Predicted Species Reactivity |
Human, Guinea Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 100%; Human: 100% |
| Image 1 | Human THP-1
 | WB Suggested Anti-MPV17L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1 cell lysate |
|
|
