| Product Number |
ARP55692_P050 |
| Product Page |
https://www.avivasysbio.com/c9orf75-antibody-middle-region-arp55692-p050.html |
| Name |
C9orf75 Antibody - middle region (ARP55692_P050) |
| Protein Size (# AA) |
433 amino acids |
| Molecular Weight |
47kDa |
| NCBI Gene Id |
286262 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Taperin |
| Alias Symbols |
DFNB79, C9orf75 |
| Peptide Sequence |
Synthetic peptide located within the following region: EAMVRCGGVERWGESDTRASPCVHILSSHFQLTPASQNDLSDFRSEPALY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Colland,F., (2004) Genome Res. 14 (7), 1324-1332 |
| Description of Target |
The specific function of C9orf75 is not yet known. |
| Protein Interactions |
PPP1CC; PPP1CA; EPS8; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TPRN (ARP55692_P050) antibody |
| Blocking Peptide |
For anti-TPRN (ARP55692_P050) antibody is Catalog # AAP55692 (Previous Catalog # AAPP36140) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human C9orf75 |
| Uniprot ID |
Q4KMQ1 |
| Protein Accession # |
NP_775962 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_173691 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TPRN |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
| Image 1 | Human Thymus
 | WB Suggested Anti-C9orf75 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Thymus |
|
|
