CDRT4 Antibody - middle region (ARP55668_P050)

Data Sheet
 
Product Number ARP55668_P050
Product Page https://www.avivasysbio.com/cdrt4-antibody-middle-region-arp55668-p050.html
Name CDRT4 Antibody - middle region (ARP55668_P050)
Protein Size (# AA) 151 amino acids
Molecular Weight 17kDa
NCBI Gene Id 284040
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name CMT1A duplicated region transcript 4
Alias Symbols FLJ36674, MGC33988, NBLA10383
Peptide Sequence Synthetic peptide located within the following region: TSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Inoue,K., (2001) Genome Res. 11 (6), 1018-1033
Description of Target The specific function of CDRT4 is not yet known.
Protein Interactions VAC14;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CDRT4 (ARP55668_P050) antibody
Blocking Peptide For anti-CDRT4 (ARP55668_P050) antibody is Catalog # AAP55668 (Previous Catalog # AAPP36111)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CDRT4
Uniprot ID Q8N9R6
Protein Name CMT1A duplicated region transcript 4 protein
Protein Accession # NP_775893
Purification Affinity Purified
Nucleotide Accession # NM_173622
Tested Species Reactivity Human
Gene Symbol CDRT4
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Heart
WB Suggested Anti-CDRT4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart