| Product Number |
ARP55626_P050 |
| Product Page |
www.avivasysbio.com/armc3-antibody-middle-region-arp55626-p050.html |
| Name |
ARMC3 Antibody - middle region (ARP55626_P050) |
| Protein Size (# AA) |
872 amino acids |
| Molecular Weight |
96kDa |
| NCBI Gene Id |
219681 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Armadillo repeat containing 3 |
| Alias Symbols |
CT81, KU-CT-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Li,X., (2006) Genetika 42 (7), 999-1003 |
| Description of Target |
The specific function of ARMC3 is not yet known.Armadillo/beta-catenin (CTNNB1; MIM 116806)-like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis (Li et al., 2006 [PubMed 16915934]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-6 DB459427.1 2-7 7-1959 BC039312.1 1-1953 1960-2806 AK098711.1 501-1347 2807-2837 BC039312.1 2801-2831 |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ARMC3 (ARP55626_P050) antibody |
| Blocking Peptide |
For anti-ARMC3 (ARP55626_P050) antibody is Catalog # AAP55626 (Previous Catalog # AAPP36003) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ARMC3 |
| Uniprot ID |
Q5W041 |
| Protein Name |
Armadillo repeat-containing protein 3 |
| Protein Accession # |
NP_775104 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_173081 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ARMC3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 79%; Rat: 86% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ARMC3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate |
|
|
