SPAG8 Antibody - middle region (ARP55622_P050)

• Name: SPAG8 Antibody - middle region (ARP55622_P050)
• Protein Size (# AA): 501 amino acids
• Molecular Weight: 53kDa
• NCBI Gene Id: 26206
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Sperm associated antigen 8
• Alias Symbols: SMP1, BS-84, CT142, HSD-1, SPAG3, CILD28, hSMP-1
• Peptide Sequence: Synthetic peptide located within the following region: PAPTKPHDYRQEQPETFWIQRAPQLPTWWPLPTQVPAAEDYLTWKEWGFT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Cheng,G.Y., (2007) Asian J. Androl. 9 (1), 23-29
• Description of Target: The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. SPAG8 is recognized by sperm agglutinating antibodies from an infertile woman. This protein is localized in germ cells of the testis at all stages of spermatogenesis and is localized to the acrosomal region of mature spermatozoa.The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein encoded by this gene is recognized by sperm agglutinating antibodies from an infertile woman. This protein is localized in germ cells of the testis at all stages of spermatogenesis and is localized to the acrosomal region of mature spermatozoa. Alternatively spliced variants that encode different protein isoforms have been described but the full-length sequences of only two have been determined.
• Protein Interactions: KLHL32; DTX2; SNRPC; CSTF2; PITX1; JMJD4; WHSC1L1; KDM3B; CARM1; PRMT5; PRMT1; PRMT2; RANBP9; UBQLN4; NEDD4L; RAN;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SPAG8 (ARP55622_P050) antibody is Catalog # AAP55622 (Previous Catalog # AAPP34247)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPAG8
• Uniprot ID: Q99932-2
• Protein Name: Sperm-associated antigen 8
• Protein Accession #: NP_758516
• Purification: Affinity Purified
• Nucleotide Accession #: NM_172312
• Tested Species Reactivity: Human
• Gene Symbol: SPAG8
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 93%; Human: 100%; Mouse: 100%; Pig: 86%; Rabbit: 93%; Rat: 100%
• Image 1: Human HeLa
  
  WB Suggested Anti-SPAG8 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Hela cell lysate