MED19 Antibody - middle region (ARP55596_P050)

Data Sheet
 
Product Number ARP55596_P050
Product Page www.avivasysbio.com/med19-antibody-middle-region-arp55596-p050.html
Name MED19 Antibody - middle region (ARP55596_P050)
Protein Size (# AA) 244 amino acids
Molecular Weight 26kDa
NCBI Gene Id 219541
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name mediator complex subunit 19
Alias Symbols LCMR1, DT2P1G7, MED19AS
Peptide Sequence Synthetic peptide located within the following region: LPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target MED19 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II .
Protein Interactions MED25; CDK19; MED6; MED13; MED12; MED26; CDK8; CCNC; MED20; MED7; MED27; MED17; MED23; MED21; MED14; MED1; POLR2L; POLR2K; POLR2J; POLR2I; POLR2H; POLR2G; POLR2F; POLR2E; POLR2D; POLR2C; POLR2B; POLR2A; MSX1; MED29; MED9; MED18; MED15; MED31; MED4; AFF4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MED19 (ARP55596_P050) antibody
Blocking Peptide For anti-MED19 (ARP55596_P050) antibody is Catalog # AAP55596
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human MED19
Uniprot ID A0JLT2
Protein Name Mediator of RNA polymerase II transcription subunit 19
Protein Accession # NP_703151
Purification Affinity Purified
Nucleotide Accession # NM_153450
Tested Species Reactivity Human
Gene Symbol MED19
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB, CHIP
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Image 1
Human Jurkat
Host: Rabbit
Target Name: MED19
Sample Type: Jurkat Whole cell lysates
Antibody Dilution: 1.0ug/ml
Image 2
HCT116
Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
Image 3
Rat testis, Rat kidney
Host: Rabbit
Target: MED19
Positive control (+): Rat testis (R-TE)
Negative control (-): Rat kidney (R-KI)
Antibody concentration: 1ug/ml
Image 4

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com