LRRC57 Antibody - N-terminal region (ARP55577_P050)

Data Sheet
 
Product Number ARP55577_P050
Product Page www.avivasysbio.com/lrrc57-antibody-n-terminal-region-arp55577-p050.html
Name LRRC57 Antibody - N-terminal region (ARP55577_P050)
Protein Size (# AA) 239 amino acids
Molecular Weight 27kDa
NCBI Gene Id 255252
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Leucine rich repeat containing 57
Alias Symbols DKFZp686H1865, FLJ36812
Peptide Sequence Synthetic peptide located within the following region: MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
Description of Target The exact function of LRRC57 remains unknown.
Protein Interactions UBC; COL7A1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LRRC57 (ARP55577_P050) antibody
Blocking Peptide For anti-LRRC57 (ARP55577_P050) antibody is Catalog # AAP55577 (Previous Catalog # AAPP33443)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC57
Uniprot ID Q8N9N7
Protein Name Leucine-rich repeat-containing protein 57
Protein Accession # NP_694992
Purification Affinity Purified
Nucleotide Accession # NM_153260
Tested Species Reactivity Human
Gene Symbol LRRC57
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 86%
Image 1
Transfected 293T
WB Suggested Anti-LRRC57 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com