| Product Number |
ARP55574_P050 |
| Product Page |
https://www.avivasysbio.com/mgc45491-antibody-middle-region-arp55574-p050.html |
| Name |
MGC45491 Antibody - middle region (ARP55574_P050) |
| Protein Size (# AA) |
242 amino acids |
| Molecular Weight |
26kDa |
| NCBI Gene Id |
221416 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Chromosome 6 open reading frame 223 |
| Peptide Sequence |
Synthetic peptide located within the following region: CRPLRPLLGFRESDSAKPASLRLLQHTPSARRNYRIAGARLMRSNYPPPL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
The exact function of MGC45491 remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-C6orf223 (ARP55574_P050) antibody |
| Blocking Peptide |
For anti-C6orf223 (ARP55574_P050) antibody is Catalog # AAP55574 (Previous Catalog # AAPP33440) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human MGC45491 |
| Uniprot ID |
Q8N319 |
| Protein Name |
Uncharacterized protein C6orf223 |
| Protein Accession # |
NP_694978 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_153246 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
C6orf223 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-MGC45491 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate |
|
|
