FYN Antibody - N-terminal region (ARP55567_P050)

• Product Number: ARP55567_P050
• Name: FYN Antibody - N-terminal region (ARP55567_P050)
• Protein Size (# AA): 482 amino acids
• Molecular Weight: 54kDa
• NCBI Gene Id: 2534
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: FYN oncogene related to SRC, FGR, YES
• Alias Symbols: SLK, SYN, p59-FYN
• Peptide Sequence: Synthetic peptide located within the following region: GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Hoe,H.S., (2008) J. Biol. Chem. 283 (10), 6288-6299
• Description of Target: FYN is a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein.This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist.
• Protein Interactions: IFITM3; EFS; WBP11; MAPT; IKBKG; PRMT6; KDM1A; SUV39H1; CMA1; TNF; IL1B; STAT3; HSP90AA1; GRIN2B; GRIN1; Mbp; MED28; CBL; TCAP; UBC; PDE4D; ENO1; SNCA; FYB; CLTC; LAT; SKAP2; ADAM15; nef; CD244; FYN; CAV1; VAV2; VAV1; ATXN1; PTPN11; KCNJ3; KCNA5; KCNA4; K
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FYN (ARP55567_P050) antibody is Catalog # AAP55567 (Previous Catalog # AAPP33433)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FYN
• Uniprot ID: P06241
• Protein Name: Tyrosine-protein kinase Fyn
• Sample Type Confirmation:

  FYN is strongly supported by BioGPS gene expression data to be expressed in HEK293T

• Protein Accession #: NP_694593
• Purification: Affinity Purified
• Nucleotide Accession #: NM_153048
• Tested Species Reactivity: Human
• Gene Symbol: FYN
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Lymph Node
  
  Rabbit Anti-FYN Antibody
  Catalog Number: ARP55567_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue
  Observed Staining: Cytoplasm, Plasma membrane, Nucleus
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: 1:600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
• Image 2: Human Heart
  
  WB Suggested Anti-FYN Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:12500
  Positive Control: Human heart
• Image 3: Human HEK293T
  
  Host: Rabbit
  Target Name: FYN
  Sample Type: 293T
  Antibody Dilution: 1.0ug/mlFYN is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells
• Image 4: Human Adult Placenta
  
  Host: Rabbit
  Target Name: FYN
  Sample Type: Human Adult Placenta
  Antibody Dilution: 1.0ug/ml
• Image 5: Human Fetal Lung
  
  Host: Rabbit
  Target Name: FYN
  Sample Type: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml