| Product Number |
ARP55555_P050 |
| Product Page |
www.avivasysbio.com/c9orf43-antibody-middle-region-arp55555-p050.html |
| Name |
C9orf43 Antibody - middle region (ARP55555_P050) |
| Protein Size (# AA) |
461 amino acids |
| Molecular Weight |
52kDa |
| NCBI Gene Id |
257169 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Chromosome 9 open reading frame 43 |
| Alias Symbols |
MGC17358 |
| Peptide Sequence |
Synthetic peptide located within the following region: PEAQAARQKKISFNFSEIMASTGWNSELKLLRILQDTDDEDEEDQSSGAE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Humphray,S.J., (2004) Nature 429 (6990), 369-374 |
| Description of Target |
The function of the C9orf43 protein remains unknown. |
| Protein Interactions |
APP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-C9orf43 (ARP55555_P050) antibody |
| Blocking Peptide |
For anti-C9orf43 (ARP55555_P050) antibody is Catalog # AAP55555 (Previous Catalog # AAPP33421) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human C9orf43 |
| Uniprot ID |
Q8TAL5 |
| Protein Name |
Uncharacterized protein C9orf43 |
| Protein Accession # |
NP_689999 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152786 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
C9orf43 |
| Predicted Species Reactivity |
Human, Dog, Pig, Yeast |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 92%; Human: 100%; Pig: 75%; Yeast: 90% |
| Image 1 | Human Liver
 | WB Suggested Anti-C9orf43 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Liver |
|
|
