| Product Number |
ARP55526_P050-FITC |
| Product Page |
www.avivasysbio.com/sema3d-antibody-middle-region-fitc-arp55526-p050-fitc.html |
| Name |
SEMA3D Antibody - middle region : FITC (ARP55526_P050-FITC) |
| Protein Size (# AA) |
777 amino acids |
| Molecular Weight |
90kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
223117 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D |
| Alias Symbols |
coll-2, Sema-Z2 |
| Peptide Sequence |
Synthetic peptide located within the following region: LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
SEMA3D induces the collapse and paralysis of neuronal growth cones. SEMA3D could potentially act as repulsive cues toward specific neuronal populations. |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-SEMA3D (ARP55526_P050-FITC) antibody |
| Blocking Peptide |
For anti-SEMA3D (ARP55526_P050-FITC) antibody is Catalog # AAP55526 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SEMA3D |
| Uniprot ID |
O95025 |
| Protein Name |
Semaphorin-3D |
| Protein Accession # |
NP_689967 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152754 |
| Gene Symbol |
SEMA3D |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | |
|
