| Product Number |
ARP55526_P050 |
| Product Page |
www.avivasysbio.com/sema3d-antibody-middle-region-arp55526-p050.html |
| Name |
SEMA3D Antibody - middle region (ARP55526_P050) |
| Protein Size (# AA) |
777 amino acids |
| Molecular Weight |
90kDa |
| NCBI Gene Id |
223117 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D |
| Alias Symbols |
coll-2, Sema-Z2 |
| Peptide Sequence |
Synthetic peptide located within the following region: LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
SEMA3D induces the collapse and paralysis of neuronal growth cones. SEMA3D could potentially act as repulsive cues toward specific neuronal populations. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SEMA3D (ARP55526_P050) antibody |
| Blocking Peptide |
For anti-SEMA3D (ARP55526_P050) antibody is Catalog # AAP55526 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SEMA3D |
| Uniprot ID |
O95025 |
| Protein Name |
Semaphorin-3D |
| Protein Accession # |
NP_689967 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152754 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SEMA3D |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human THP-1
 | WB Suggested Anti-SEMA3D Antibody Titration: 0.2-1 ug/ml
Positive Control: THP-1 cell lysate |
|
|
