SEMA3D Antibody - middle region (ARP55526_P050)

Data Sheet
 
Product Number ARP55526_P050
Product Page https://www.avivasysbio.com/sema3d-antibody-middle-region-arp55526-p050.html
Name SEMA3D Antibody - middle region (ARP55526_P050)
Protein Size (# AA) 777 amino acids
Molecular Weight 90kDa
NCBI Gene Id 223117
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D
Alias Symbols coll-2, Sema-Z2
Peptide Sequence Synthetic peptide located within the following region: LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target SEMA3D induces the collapse and paralysis of neuronal growth cones. SEMA3D could potentially act as repulsive cues toward specific neuronal populations.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SEMA3D (ARP55526_P050) antibody
Blocking Peptide For anti-SEMA3D (ARP55526_P050) antibody is Catalog # AAP55526
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SEMA3D
Uniprot ID O95025
Protein Name Semaphorin-3D
Protein Accession # NP_689967
Purification Affinity Purified
Nucleotide Accession # NM_152754
Tested Species Reactivity Human
Gene Symbol SEMA3D
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human THP-1
WB Suggested Anti-SEMA3D Antibody Titration: 0.2-1 ug/ml
Positive Control: THP-1 cell lysate