| Product Number |
ARP55484_P050 |
| Product Page |
www.avivasysbio.com/ncaph2-antibody-n-terminal-region-arp55484-p050.html |
| Name |
NCAPH2 Antibody - N-terminal region (ARP55484_P050) |
| Protein Size (# AA) |
605 amino acids |
| Molecular Weight |
68kDa |
| Subunit |
H2 |
| NCBI Gene Id |
29781 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Non-SMC condensin II complex, subunit H2 |
| Alias Symbols |
CAPH2 |
| Peptide Sequence |
Synthetic peptide located within the following region: SGVPQEAENEFLSLDDFPDSRTNVDLKNDQTPSEVLIIPLLPMALVAPDE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ono,T., (2003) Cell 115 (1), 109-121 |
| Description of Target |
Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 and SMC4, but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II.Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 (MIM 605576) and SMC4 (MIM 605575), but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II (Ono et al., 2003 [PubMed 14532007]).[supplied by OMIM]. |
| Protein Interactions |
EGLN3; USHBP1; SNRPC; UBC; EGFR; LMO2; FOLR1; NCAPG2; NCAPD3; SMC2; SMC4; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NCAPH2 (ARP55484_P050) antibody |
| Blocking Peptide |
For anti-NCAPH2 (ARP55484_P050) antibody is Catalog # AAP55484 (Previous Catalog # AAPP33376) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NCAPH2 |
| Uniprot ID |
Q6IBW4 |
| Protein Name |
Condensin-2 complex subunit H2 |
| Sample Type Confirmation |
NCAPH2 is strongly supported by BioGPS gene expression data to be expressed in 721_B |
| Protein Accession # |
NP_689512 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152299 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NCAPH2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 75%; Horse: 85%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92% |
| Image 1 | Human 721_B
 | WB Suggested Anti-NCAPH2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysateNCAPH2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells |
|
