| Product Number |
ARP55479_P050 |
| Product Page |
www.avivasysbio.com/epn2-antibody-middle-region-arp55479-p050.html |
| Name |
EPN2 Antibody - middle region (ARP55479_P050) |
| Protein Size (# AA) |
584 amino acids |
| Molecular Weight |
62kDa |
| NCBI Gene Id |
22905 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Epsin 2 |
| Alias Symbols |
EHB21 |
| Peptide Sequence |
Synthetic peptide located within the following region: SHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAM |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Olsen,J.V., (2006) Cell 127 (3), 635-648 |
| Description of Target |
This protein interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. It is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis.This gene encodes a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. |
| Protein Interactions |
rev; UBC; APOE; UBQLN2; ITSN1; RNF11; EPS15; YWHAG; TUBA1B; LAPTM5; CLTC; TFAP2A; Eps15l1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-EPN2 (ARP55479_P050) antibody |
| Blocking Peptide |
For anti-EPN2 (ARP55479_P050) antibody is Catalog # AAP55479 (Previous Catalog # AAPP33371) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human EPN2 |
| Uniprot ID |
Q52LD0 |
| Protein Name |
Epsin 2 EMBL AAH93974.1 |
| Sample Type Confirmation |
EPN2 is supported by BioGPS gene expression data to be expressed in HEK293T |
| Protein Accession # |
NP_683723 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_148921 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
EPN2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human 293T
 | WB Suggested Anti-EPN2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysateEPN2 is supported by BioGPS gene expression data to be expressed in HEK293T |
|
|
