| Product Number |
ARP55454_P050 |
| Product Page |
www.avivasysbio.com/cfap53-antibody-n-terminal-region-arp55454-p050.html |
| Name |
CFAP53 Antibody - N-terminal region (ARP55454_P050) |
| Protein Size (# AA) |
514 amino acids |
| Molecular Weight |
62kDa |
| NCBI Gene Id |
220136 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
cilia and flagella associated protein 53 |
| Alias Symbols |
HTX6, CCDC11 |
| Peptide Sequence |
Synthetic peptide located within the following region: YSQRFGTVQREVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAIL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004) |
| Description of Target |
This gene belongs to the CFAP53 family. It was found to be differentially expressed by the ciliated cells of frog epidermis and in skin fibroblasts from human. Mutations in this gene are associated with visceral heterotaxy-6, which implicates this gene in determination of left-right asymmetric patterning. |
| Protein Interactions |
TNIP1; CEP70; CBY1; HMG20A; PNMA1; TRIM23; APP; CCDC85B; TEX11; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CFAP53 (ARP55454_P050) antibody |
| Blocking Peptide |
For anti-CFAP53 (ARP55454_P050) antibody is Catalog # AAP55454 (Previous Catalog # AAPP33346) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC11 |
| Uniprot ID |
Q96M91 |
| Protein Name |
cilia- and flagella-associated protein 53 |
| Publications |
Perles, Z. et al. A human laterality disorder associated with recessive CCDC11 mutation. J. Med. Genet. 49, 386-90 (2012). 22577226 |
| Protein Accession # |
NP_659457 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_145020 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CFAP53 |
| Predicted Species Reactivity |
Human, Cow, Dog, Guinea Pig, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 79%; Guinea Pig: 77%; Horse: 85%; Human: 100%; Pig: 85% |
| Image 1 | Human 293T
 | WB Suggested Anti-CCDC11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate |
|
| Image 2 | Human Lung, Human Brain
 | Host: Rabbit
Target: CCDC11
Positive control (+): Human Lung (LU)
Negative control (-): Human Brain (BR)
Antibody concentration: 1ug/ml |
|
