| Product Number |
ARP55415_P050 |
| Product Page |
www.avivasysbio.com/ccndbp1-antibody-middle-region-arp55415-p050.html |
| Name |
CCNDBP1 Antibody - middle region (ARP55415_P050) |
| Protein Size (# AA) |
232 amino acids |
| Molecular Weight |
26kDa |
| NCBI Gene Id |
23582 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cyclin D-type binding-protein 1 |
| Alias Symbols |
HHM, DIP1, GCIP |
| Peptide Sequence |
Synthetic peptide located within the following region: NSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene was identified by the interaction of its gene product with Grap2, a leukocyte-specific adaptor protein important for immune cell signaling. The protein encoded by this gene was shown to interact with cyclin D. Transfection of this gene in cells was reported to reduce the phosphorylation of Rb gene product by cyclin D-dependent protein kinase, and inhibit E2F1-mediated transcription activity. This protein was also found to interact with helix-loop-helix protein E12 and is thought to be a negative regulator of liver-specific gene expression. Several alternatively spliced variants have been found for this gene. |
| Protein Interactions |
TYMSOS; ZNRF2P1; C6orf226; FAM74A4; ZNF564; ZNF555; TMEM120B; TRAPPC5; RPL39L; ZNF670; NEURL3; ZNF697; ZNF439; C22orf23; ZGPAT; ZNF394; RBP5; FAM110A; THAP7; TTC23; DMRT3; ARHGAP22; CCDC146; ZNF490; THAP10; IMP3; FAM64A; ZNF581; MRPL15; CNNM3; SYF2; NUDCD |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CCNDBP1 (ARP55415_P050) antibody |
| Blocking Peptide |
For anti-CCNDBP1 (ARP55415_P050) antibody is Catalog # AAP55415 (Previous Catalog # AAPP44423) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CCNDBP1 |
| Uniprot ID |
O95273 |
| Protein Accession # |
NP_411241 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_037370 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CCNDBP1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 85%; Rabbit: 100%; Rat: 92% |
| Image 1 | Human Liver
 | WB Suggested Anti-CCNDBP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver |
|
|
