CCNDBP1 Antibody - middle region (ARP55414_P050)

Data Sheet
 
Product Number ARP55414_P050
Product Page www.avivasysbio.com/ccndbp1-antibody-middle-region-arp55414-p050.html
Name CCNDBP1 Antibody - middle region (ARP55414_P050)
Protein Size (# AA) 360 amino acids
Molecular Weight 40kDa
NCBI Gene Id 23582
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cyclin D-type binding-protein 1
Alias Symbols HHM, DIP1, GCIP
Peptide Sequence Synthetic peptide located within the following region: KNVDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene was identified by the interaction of its gene product with Grap2, a leukocyte-specific adaptor protein important for immune cell signaling. The protein encoded by this gene was shown to interact with cyclin D. Transfection of this gene in cells
Protein Interactions TYMSOS; ZNRF2P1; C6orf226; FAM74A4; ZNF564; ZNF555; TMEM120B; TRAPPC5; RPL39L; ZNF670; NEURL3; ZNF697; ZNF439; C22orf23; ZGPAT; ZNF394; RBP5; FAM110A; THAP7; TTC23; DMRT3; ARHGAP22; CCDC146; ZNF490; THAP10; IMP3; FAM64A; ZNF581; MRPL15; CNNM3; SYF2; NUDCD
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CCNDBP1 (ARP55414_P050) antibody
Blocking Peptide For anti-CCNDBP1 (ARP55414_P050) antibody is Catalog # AAP55414 (Previous Catalog # AAPP33306)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CCNDBP1
Uniprot ID O95273
Protein Name Cyclin-D1-binding protein 1
Protein Accession # NP_036274
Purification Affinity Purified
Nucleotide Accession # NM_012142
Tested Species Reactivity Human
Gene Symbol CCNDBP1
Predicted Species Reactivity Human, Mouse, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 77%; Dog: 85%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Mouse: 85%; Rabbit: 77%
Image 1
Human Small Intestine
WB Suggested Anti-CCNDBP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com