| Product Number |
ARP55378_P050 |
| Product Page |
https://www.avivasysbio.com/tspyl4-antibody-middle-region-arp55378-p050.html |
| Name |
TSPYL4 Antibody - middle region (ARP55378_P050) |
| Protein Size (# AA) |
414 amino acids |
| Molecular Weight |
45kDa |
| NCBI Gene Id |
23270 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
TSPY-like 4 |
| Alias Symbols |
dJ486I3.2 |
| Peptide Sequence |
Synthetic peptide located within the following region: QKEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Mungall,A.J., (2003) Nature 425 (6960), 805-811 |
| Description of Target |
TSPYL4 belongs to the nucleosome assembly protein (NAP) family. The functions of TSPYL4 remain unknown. |
| Protein Interactions |
CDK5RAP3; TFIP11; TRIM38; PNMA1; NAP1L3; UBC; CCDC85B; NINL; CELSR3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TSPYL4 (ARP55378_P050) antibody |
| Blocking Peptide |
For anti-TSPYL4 (ARP55378_P050) antibody is Catalog # AAP55378 (Previous Catalog # AAPP33250) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TSPYL4 |
| Uniprot ID |
Q9UJ04 |
| Protein Name |
Testis-specific Y-encoded-like protein 4 |
| Sample Type Confirmation |
TSPYL4 is supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_067680 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_021648 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TSPYL4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 83%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-TSPYL4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysateTSPYL4 is supported by BioGPS gene expression data to be expressed in Jurkat |
|
