GDF2 Antibody - middle region (ARP55339_P050)

Data Sheet
 
Product Number ARP55339_P050
Product Page www.avivasysbio.com/gdf2-antibody-middle-region-arp55339-p050.html
Name GDF2 Antibody - middle region (ARP55339_P050)
Protein Size (# AA) 429 amino acids
Molecular Weight 47kDa
NCBI Gene Id 2658
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Growth differentiation factor 2
Alias Symbols BMP9, HHT5, BMP-9
Peptide Sequence Synthetic peptide located within the following region: CFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDM
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference David,L., (2008) Circ. Res. 102 (8), 914-922
Description of Target GDF2 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in rodents suggest that this protein plays a role in the adult liver and in differentiation of cholinergic central nervous system neurons.The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in rodents suggest that this protein plays a role in the adult liver and in differentiation of cholinergic central nervous system neurons.
Protein Interactions BMPR2; ACVR2B; ACVR2A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GDF2 (ARP55339_P050) antibody
Blocking Peptide For anti-GDF2 (ARP55339_P050) antibody is Catalog # AAP55339 (Previous Catalog # AAPP33211)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GDF2
Uniprot ID Q9UK05
Protein Name Growth/differentiation factor 2
Protein Accession # NP_057288
Purification Affinity Purified
Nucleotide Accession # NM_016204
Tested Species Reactivity Human, Mouse
Gene Symbol GDF2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human HepG2
WB Suggested Anti-GDF2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
Image 2
Mouse Pancreas
Host: Mouse
Target Name: GDF2
Sample Tissue: Mouse Pancreas
Antibody Dilution: 1ug/ml
Image 3
Mouse Pancreas
Host: Rabbit
Target Name: GDF2
Sample Tissue: Mouse Pancreas
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com