C2orf25 Antibody - middle region (ARP55333_P050)

Data Sheet
 
Product Number ARP55333_P050
Product Page www.avivasysbio.com/c2orf25-antibody-middle-region-arp55333-p050.html
Name C2orf25 Antibody - middle region (ARP55333_P050)
Protein Size (# AA) 296 amino acids
Molecular Weight 33kDa
NCBI Gene Id 27249
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Methylmalonic aciduria (cobalamin deficiency) cblD type, with homocystinuria
Alias Symbols cblD, C2orf25, CL25022
Peptide Sequence Synthetic peptide located within the following region: RAEGYWADFIDPSSGLAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Coelho,D., (2008) N. Engl. J. Med. 358 (14), 1454-1464
Description of Target The function of C2orf25 remains unknown.Vitamin B12 (cobalamin) is an essential cofactor in several metabolic pathways. Intracellular conversion of cobalamin to adenosylcobalamin in mitochondria and to methylcobalamin in cytoplasm is necessary for homeostasis of methylmalonic acid and homocysteine. C2ORF25 encodes a protein involved in an early step of cobalamin metabolism (Coelho et al., 2008 [PubMed 18385497]).[supplied by OMIM].
Protein Interactions MMACHC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MMADHC (ARP55333_P050) antibody
Blocking Peptide For anti-MMADHC (ARP55333_P050) antibody is Catalog # AAP55333 (Previous Catalog # AAPP33205)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human C2orf25
Uniprot ID Q9H3L0
Protein Name Methylmalonic aciduria and homocystinuria type D protein, mitochondrial
Protein Accession # NP_056517
Purification Affinity Purified
Nucleotide Accession # NM_015702
Tested Species Reactivity Human
Gene Symbol MMADHC
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human Muscle
WB Suggested Anti-C2orf25 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com