Product Number |
ARP55304_P050 |
Product Page |
www.avivasysbio.com/c1orf144-antibody-n-terminal-region-arp55304-p050.html |
Name |
C1orf144 Antibody - N-terminal region (ARP55304_P050) |
Protein Size (# AA) |
133 amino acids |
Molecular Weight |
15kDa |
NCBI Gene Id |
26099 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Chromosome 1 open reading frame 144 |
Alias Symbols |
C1orf144 |
Peptide Sequence |
Synthetic peptide located within the following region: MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Protein Interactions |
UBC; P3H1; EHD4; NT5C2; MTMR2; ZPR1; SRP14; SRP9; ELAVL1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SZRD1 (ARP55304_P050) antibody |
Blocking Peptide |
For anti-SZRD1 (ARP55304_P050) antibody is Catalog # AAP55304 (Previous Catalog # AAPP33135) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf144 |
Uniprot ID |
Q7Z422-4 |
Protein Name |
SUZ domain-containing protein 1 |
Sample Type Confirmation |
SZRD1 is supported by BioGPS gene expression data to be expressed in RPMI 8226 |
Protein Accession # |
NP_056424 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_015609 |
Tested Species Reactivity |
Human |
Gene Symbol |
SZRD1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | Human RPMI 8226
| WB Suggested Anti-C1orf144 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: RPMI 8226 cell lysateSZRD1 is supported by BioGPS gene expression data to be expressed in RPMI 8226 |
|
Image 2 | Human Adult Liver
| Rabbit Anti-C1orf144 Antibody
Catalog Number: ARP55304_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Cytoplasm in hepatocytes, moderate signal, moderate tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
|
Image 3 | Human Adult Liver
| Rabbit Anti-C1orf144 Antibody
Catalog Number: ARP55304_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Nuclear (strong) and Cytoplasm (weak) in hepatocytes, moderate signal, wide tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
|