C1orf144 Antibody - N-terminal region (ARP55304_P050)

Data Sheet
 
Product Number ARP55304_P050
Product Page www.avivasysbio.com/c1orf144-antibody-n-terminal-region-arp55304-p050.html
Name C1orf144 Antibody - N-terminal region (ARP55304_P050)
Protein Size (# AA) 133 amino acids
Molecular Weight 15kDa
NCBI Gene Id 26099
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Chromosome 1 open reading frame 144
Alias Symbols C1orf144
Peptide Sequence Synthetic peptide located within the following region: MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Protein Interactions UBC; P3H1; EHD4; NT5C2; MTMR2; ZPR1; SRP14; SRP9; ELAVL1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SZRD1 (ARP55304_P050) antibody
Blocking Peptide For anti-SZRD1 (ARP55304_P050) antibody is Catalog # AAP55304 (Previous Catalog # AAPP33135)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf144
Uniprot ID Q7Z422-4
Protein Name SUZ domain-containing protein 1
Sample Type Confirmation

SZRD1 is supported by BioGPS gene expression data to be expressed in RPMI 8226

Protein Accession # NP_056424
Purification Affinity Purified
Nucleotide Accession # NM_015609
Tested Species Reactivity Human
Gene Symbol SZRD1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human RPMI 8226
WB Suggested Anti-C1orf144 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: RPMI 8226 cell lysateSZRD1 is supported by BioGPS gene expression data to be expressed in RPMI 8226
Image 2
Human Adult Liver
Rabbit Anti-C1orf144 Antibody
Catalog Number: ARP55304_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Cytoplasm in hepatocytes, moderate signal, moderate tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 – 2.0 sec
Protocol located in Reviews and Data.
Image 3
Human Adult Liver
Rabbit Anti-C1orf144 Antibody
Catalog Number: ARP55304_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Nuclear (strong) and Cytoplasm (weak) in hepatocytes, moderate signal, wide tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 – 2.0 sec
Protocol located in Reviews and Data.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com