ARHGEF26 Antibody - N-terminal region (ARP55292_P050)

Data Sheet
 
Product Number ARP55292_P050
Product Page www.avivasysbio.com/arhgef26-antibody-n-terminal-region-arp55292-p050.html
Name ARHGEF26 Antibody - N-terminal region (ARP55292_P050)
Protein Size (# AA) 871 amino acids
Molecular Weight 97kDa
NCBI Gene Id 26084
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Rho guanine nucleotide exchange factor (GEF) 26
Alias Symbols SGEF, CSGEF, HMFN1864
Peptide Sequence Synthetic peptide located within the following region: MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLITD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target SGEF activates RhoG GTPase by promoting the exchange of GDP by GTP. SGEF is required for the formation of membrane ruffles during macropinocytosis. SGEF is also required for the formation of cup-like structures during trans-endothelial migration of leukocyte.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ARHGEF26 (ARP55292_P050) antibody
Blocking Peptide For anti-ARHGEF26 (ARP55292_P050) antibody is Catalog # AAP55292 (Previous Catalog # AAPP33123)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SGEF
Uniprot ID Q96DR7
Protein Name Rho guanine nucleotide exchange factor 26
Protein Accession # NP_056410
Purification Affinity Purified
Nucleotide Accession # NM_015595
Tested Species Reactivity Human
Gene Symbol ARHGEF26
Predicted Species Reactivity Human, Mouse, Rat, Cow, Pig, Rabbit, Yeast
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 90%
Image 1
Human OVCAR-3
WB Suggested Anti-ARHGEF26 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: OVCAR-3 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com