KIAA0776 Antibody - middle region (ARP55228_P050)

Data Sheet
 
Product Number ARP55228_P050
Product Page www.avivasysbio.com/kiaa0776-antibody-middle-region-arp55228-p050.html
Name KIAA0776 Antibody - middle region (ARP55228_P050)
Protein Size (# AA) 794 amino acids
Molecular Weight 89kDa
NCBI Gene Id 23376
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name UFM1-specific ligase 1
Alias Symbols NLBP, RCAD, Maxer, KIAA0776
Peptide Sequence Synthetic peptide located within the following region: EYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDLQEEVSNLYNNIR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target KIAA0776 is an E3 UFM1-protein ligase that mediates ufmylation of target proteins such as DDRGK1/C20orf116. The function of ufmylation is unknown.
Protein Interactions FUS; UBC; ZNF622; CDK5RAP3; CASP4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-UFL1 (ARP55228_P050) antibody
Blocking Peptide For anti-UFL1 (ARP55228_P050) antibody is Catalog # AAP55228 (Previous Catalog # AAPP33055)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human KIAA0776
Uniprot ID O94874
Protein Name E3 UFM1-protein ligase 1
Protein Accession # NP_056138
Purification Affinity Purified
Nucleotide Accession # NM_015323
Tested Species Reactivity Human
Gene Symbol UFL1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human kidney
WB Suggested Anti-KIAA0776 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com