FBXO28 Antibody - middle region (ARP55192_P050)

• Product Number: ARP55192_P050
• Name: FBXO28 Antibody - middle region (ARP55192_P050)
• Protein Size (# AA): 368 amino acids
• Molecular Weight: 41kDa
• NCBI Gene Id: 23219
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: F-box protein 28
• Alias Symbols: Fbx28, CENP-30
• Peptide Sequence: Synthetic peptide located within the following region: ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648
• Description of Target: Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].
• Protein Interactions: PLEKHF2; SDCBP2; SPAG5; SKP1; GOLGA2; PAK1; LYN; HSP90AA1; GK; UBC; PSMB1; Cep55; TRAF2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FBXO28 (ARP55192_P050) antibody is Catalog # AAP55192 (Previous Catalog # AAPP33019)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FBXO28
• Uniprot ID: Q9NVF7
• Protein Name: F-box only protein 28
• Protein Accession #: NP_055991
• Purification: Affinity Purified
• Nucleotide Accession #: NM_015176
• Tested Species Reactivity: Human
• Gene Symbol: FBXO28
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%
• Image 1: Human MCF-7
  
  WB Suggested Anti-FBXO28 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: MCF7 cell lysate