GPD1L Antibody - middle region (ARP55177_P050)

• Name: GPD1L Antibody - middle region (ARP55177_P050)
• Protein Size (# AA): 351 amino acids
• Molecular Weight: 38kDa
• NCBI Gene Id: 23171
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Glycerol-3-phosphate dehydrogenase 1-like
• Alias Symbols: GPD1-L
• Peptide Sequence: Synthetic peptide located within the following region: ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: London,B., (2007) Circulation 116 (20), 2260-2268
• Description of Target: GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).
• Protein Interactions: ELAVL1; UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GPD1L (ARP55177_P050) antibody is Catalog # AAP55177 (Previous Catalog # AAPP32795)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GPD1L
• Uniprot ID: Q8N335
• Protein Name: Glycerol-3-phosphate dehydrogenase 1-like protein
• Protein Accession #: NP_055956
• Purification: Affinity Purified
• Nucleotide Accession #: NM_015141
• Tested Species Reactivity: Human
• Gene Symbol: GPD1L
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Image 1: Human Muscle
  
  WB Suggested Anti-GPD1L Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human Muscle