CPEB3 Antibody - middle region (ARP55103_P050)

• Product Number: ARP55103_P050
• Name: CPEB3 Antibody - middle region (ARP55103_P050)
• Protein Size (# AA): 698 amino acids
• Molecular Weight: 76 kDa
• NCBI Gene Id: 22849
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cytoplasmic polyadenylation element binding protein 3
• Alias Symbols: -
• Peptide Sequence: Synthetic peptide located within the following region: RTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKHYPPSG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Heilig,R., (2006) Science 313 (5794), 1788-1792
• Description of Target: The exact function of CPEB3 remains unknown.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-CPEB3 (ARP55103_P050) antibody is Catalog # AAP55103 (Previous Catalog # AAPP32721)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPEB3
• Uniprot ID: Q8NE35
• Protein Name: Cytoplasmic polyadenylation element-binding protein 3
• Protein Accession #: NP_055727
• Purification: Affinity Purified
• Nucleotide Accession #: NM_014912
• Tested Species Reactivity: Human
• Gene Symbol: CPEB3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Image 1: 721_B Whole Cell
  
  Host: Rabbit
  Target Name: CPEB3
  Sample Type: 721_B Whole Cell
  Lane A: Primary Antibody
  Lane B: Primary Antibody + Blocking Peptide
  Primary Antibody Concentration: 1ug/ml
  Peptide Concentration: 5ug/ml
  Lysate Quantity: 25ug/lane
  Gel Concentration: 0.12%
• Image 2: Human 721_B
  
  WB Suggested Anti-CPEB3 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: 721_B cell lysate
• Image 3:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.