| Product Number |
ARP55099_P050 |
| Product Page |
www.avivasysbio.com/vash1-antibody-n-terminal-region-arp55099-p050.html |
| Name |
VASH1 Antibody - N-terminal region (ARP55099_P050) |
| Protein Size (# AA) |
365 amino acids |
| Molecular Weight |
41kDa |
| NCBI Gene Id |
22846 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Vasohibin 1 |
| Alias Symbols |
TTCP 1, KIAA1036 |
| Peptide Sequence |
Synthetic peptide located within the following region: ATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPER |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Yoshinaga,K., (2008) Cancer Sci. 99 (5), 914-919 |
| Description of Target |
VASH1 is the angiogenesis inhibitor. It inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. VASH1 does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. It acts in an autocrine manner. VASH1 inhibits artery neointimal formation and macrophage infiltration. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests. |
| Protein Interactions |
DHPS; CCDC23; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-VASH1 (ARP55099_P050) antibody |
| Blocking Peptide |
For anti-VASH1 (ARP55099_P050) antibody is Catalog # AAP55099 (Previous Catalog # AAPP32717) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human VASH1 |
| Uniprot ID |
Q7L8A9 |
| Protein Name |
Vasohibin-1 |
| Protein Accession # |
NP_055724 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_014909 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
VASH1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79% |
| Image 1 | Human 721_B
 | WB Suggested Anti-VASH1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate |
|
|
