Product Number |
ARP55094_P050 |
Product Page |
www.avivasysbio.com/vwa5a-antibody-c-terminal-region-arp55094-p050.html |
Name |
Vwa5a Antibody - C-terminal region (ARP55094_P050) |
Protein Size (# AA) |
793 amino acids |
Molecular Weight |
87kDa |
NCBI Gene Id |
67776 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Von Willebrand factor A domain containing 5A |
Alias Symbols |
BCSC-, Loh11, BCSC-1, AW552491, Loh11cr2a, E130119J22, 5830475I06Rik |
Peptide Sequence |
Synthetic peptide located within the following region: VLSSFTAFIAINKELNKPVQGPLAHRVIPRPVMAGSSSMRFYSSFSGGFK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Vwa5a may play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in may contribute directly to or modify tumorigenesis. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Vwa5a (ARP55094_P050) antibody |
Blocking Peptide |
For anti-Vwa5a (ARP55094_P050) antibody is Catalog # AAP55094 (Previous Catalog # AAPP32712) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
Uniprot ID |
Q99KC8 |
Protein Name |
von Willebrand factor A domain-containing protein 5A |
Protein Accession # |
NP_766355 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_172767 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Vwa5a |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 92%; Guinea Pig: 79%; Horse: 83%; Human: 100%; Mouse: 100%; Pig: 92%; Rat: 100% |
Image 1 | Mouse Kidney
| WB Suggested Anti-Vwa5a Antibody Titration: 1.0 ug/ml Positive Control: Mouse Kidney |
|
|