Vwa5a Antibody - C-terminal region (ARP55094_P050)

Data Sheet
 
Product Number ARP55094_P050
Product Page www.avivasysbio.com/vwa5a-antibody-c-terminal-region-arp55094-p050.html
Name Vwa5a Antibody - C-terminal region (ARP55094_P050)
Protein Size (# AA) 793 amino acids
Molecular Weight 87kDa
NCBI Gene Id 67776
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Von Willebrand factor A domain containing 5A
Alias Symbols BCSC-, Loh11, BCSC-1, AW552491, Loh11cr2a, E130119J22, 5830475I06Rik
Peptide Sequence Synthetic peptide located within the following region: VLSSFTAFIAINKELNKPVQGPLAHRVIPRPVMAGSSSMRFYSSFSGGFK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Vwa5a may play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in may contribute directly to or modify tumorigenesis.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Vwa5a (ARP55094_P050) antibody
Blocking Peptide For anti-Vwa5a (ARP55094_P050) antibody is Catalog # AAP55094 (Previous Catalog # AAPP32712)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Uniprot ID Q99KC8
Protein Name von Willebrand factor A domain-containing protein 5A
Protein Accession # NP_766355
Purification Affinity Purified
Nucleotide Accession # NM_172767
Tested Species Reactivity Mouse
Gene Symbol Vwa5a
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 85%; Dog: 92%; Guinea Pig: 79%; Horse: 83%; Human: 100%; Mouse: 100%; Pig: 92%; Rat: 100%
Image 1
Mouse Kidney
WB Suggested Anti-Vwa5a Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com