SENP1 Antibody - middle region (ARP55082_P050)

Data Sheet
 
Product Number ARP55082_P050
Product Page www.avivasysbio.com/senp1-antibody-middle-region-arp55082-p050.html
Name SENP1 Antibody - middle region (ARP55082_P050)
Protein Size (# AA) 643 amino acids
Molecular Weight 73kDa
NCBI Gene Id 29843
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name SUMO1/sentrin specific peptidase 1
Alias Symbols SuPr-2
Peptide Sequence Synthetic peptide located within the following region: PQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ohbayashi,N., (2008) Biochem. Biophys. Res. Commun. 371 (4), 823-828
Description of Target The covalent modification of proteins by the small ubiquitin-like protein SUMO is implicated in the regulation of nucleocytoplasmic transport, genomic stability, gene transcription, and other processes. Sumoylation is catalyzed on target lysine residues by a multienzyme process and is reversed by desumoylating enzymes such as SENP1.
Protein Interactions USP25; RABGAP1; SUMO1; TP53; SP100; SUMO2; SUMO3; RANGAP1; PRDM1; BAG3; LMNA; APP; UBD; U90; HIPK2; ISG15; RANBP2; HDAC2; ELAVL1; UBC; GCM1; RUVBL2; HDAC1; PARP1; HDAC4; KCNK1; SENP1; SP3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SENP1 (ARP55082_P050) antibody
Blocking Peptide For anti-SENP1 (ARP55082_P050) antibody is Catalog # AAP55082 (Previous Catalog # AAPP32691)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SENP1
Uniprot ID Q9P0U3-2
Protein Name Sentrin-specific protease 1
Protein Accession # NP_055369
Purification Affinity Purified
Nucleotide Accession # NM_014554
Tested Species Reactivity Human
Gene Symbol SENP1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Image 1
Human HepG2
WB Suggested Anti-SENP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com