TMOD2 Antibody - N-terminal region (ARP55079_P050)

Data Sheet
 
Product Number ARP55079_P050
Product Page www.avivasysbio.com/tmod2-antibody-n-terminal-region-arp55079-p050.html
Name TMOD2 Antibody - N-terminal region (ARP55079_P050)
Protein Size (# AA) 351 amino acids
Molecular Weight 39kDa
NCBI Gene Id 29767
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Tropomodulin 2 (neuronal)
Alias Symbols NTMOD, N-TMOD
Peptide Sequence Synthetic peptide located within the following region: LDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDRED
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Pawlak,G., (2004) Int. J. Cancer 110 (3), 368-373
Description of Target TMOD2 is a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. It caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin.
Protein Interactions UBC; PAN2; SF3B3; SF3B2; SAFB; ABCC1; APP; TPM3; TPM1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TMOD2 (ARP55079_P050) antibody
Blocking Peptide For anti-TMOD2 (ARP55079_P050) antibody is Catalog # AAP55079 (Previous Catalog # AAPP32688)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TMOD2
Uniprot ID Q9NZR1
Protein Name Tropomodulin-2
Protein Accession # NP_055363
Purification Affinity Purified
Nucleotide Accession # NM_014548
Tested Species Reactivity Human
Gene Symbol TMOD2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Image 1
Human HeLa
WB Suggested Anti-TMOD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com