MTCH2 Antibody - N-terminal region (ARP55028_P050)

Data Sheet
 
Product Number ARP55028_P050
Product Page www.avivasysbio.com/mtch2-antibody-n-terminal-region-arp55028-p050.html
Name MTCH2 Antibody - N-terminal region (ARP55028_P050)
Protein Size (# AA) 303 amino acids
Molecular Weight 33kDa
NCBI Gene Id 23788
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Mitochondrial carrier 2
Alias Symbols MIMP, HSPC032, SLC25A50
Peptide Sequence Synthetic peptide located within the following region: TIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Grinberg,M., (2005) Mol. Cell. Biol. 25 (11), 4579-4590
Description of Target MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats. The substrate transported is not yet known. It induces mitochondrial depolarization.
Protein Interactions RNF2; XRN1; FBXO6; vpr; UBC; ESR1; FMNL1; HNRNPU; UBD; SUMO2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MTCH2 (ARP55028_P050) antibody
Blocking Peptide For anti-MTCH2 (ARP55028_P050) antibody is Catalog # AAP55028 (Previous Catalog # AAPP32289)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MTCH2
Uniprot ID Q9Y6C9
Protein Name Mitochondrial carrier homolog 2
Sample Type Confirmation

MTCH2 is supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_055157
Purification Affinity Purified
Nucleotide Accession # NM_014342
Tested Species Reactivity Human
Gene Symbol MTCH2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 79%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human 721_B
WB Suggested Anti-MTCH2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysateMTCH2 is supported by BioGPS gene expression data to be expressed in 721_B
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com