Product Number |
ARP55027_P050 |
Product Page |
www.avivasysbio.com/mtch2-antibody-n-terminal-region-arp55027-p050.html |
Name |
MTCH2 Antibody - N-terminal region (ARP55027_P050) |
Protein Size (# AA) |
303 amino acids |
Molecular Weight |
33kDa |
NCBI Gene Id |
23788 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Mitochondrial carrier 2 |
Alias Symbols |
MIMP, HSPC032, SLC25A50 |
Peptide Sequence |
Synthetic peptide located within the following region: ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Grinberg,M., (2005) Mol. Cell. Biol. 25 (11), 4579-4590 |
Description of Target |
MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats. The substrate transported is not yet known. It induces mitochondrial depolarization. |
Protein Interactions |
RNF2; XRN1; FBXO6; vpr; UBC; ESR1; FMNL1; HNRNPU; UBD; SUMO2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-MTCH2 (ARP55027_P050) antibody |
Blocking Peptide |
For anti-MTCH2 (ARP55027_P050) antibody is Catalog # AAP55027 (Previous Catalog # AAPP32288) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MTCH2 |
Uniprot ID |
Q9Y6C9 |
Protein Name |
Mitochondrial carrier homolog 2 |
Sample Type Confirmation |
MTCH2 is supported by BioGPS gene expression data to be expressed in 721_B |
Protein Accession # |
NP_055157 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_014342 |
Tested Species Reactivity |
Human |
Gene Symbol |
MTCH2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 77%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
Image 1 | Human 721_B
| WB Suggested Anti-MTCH2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: 721_B cell lysateMTCH2 is supported by BioGPS gene expression data to be expressed in 721_B |
|
|