Product Number |
ARP54998_P050 |
Product Page |
www.avivasysbio.com/nomo1-antibody-c-terminal-region-arp54998-p050.html |
Name |
NOMO1 Antibody - C-terminal region (ARP54998_P050) |
Protein Size (# AA) |
1222 amino acids |
Molecular Weight |
134kDa |
NCBI Gene Id |
23420 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
NODAL modulator 1 |
Alias Symbols |
PM5, Nomo |
Peptide Sequence |
Synthetic peptide located within the following region: QDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Lim,J., (2006) Cell 125 (4), 801-814 |
Description of Target |
NOMO1 was originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE). This gene encodes a protein originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE). |
Protein Interactions |
UBC; TRIM63; TRIM55; EXOSC10; FBXO6; UPF2; STAT1; ECT2; TIMM10; PLEC; ILF3; UBQLN4; SHBG; CDK2; TOM1L1; BAG6; NCLN; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NOMO1 (ARP54998_P050) antibody |
Blocking Peptide |
For anti-NOMO1 (ARP54998_P050) antibody is Catalog # AAP54998 (Previous Catalog # AAPP32259) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human NOMO1 |
Uniprot ID |
P69849 |
Protein Name |
Nodal modulator 3 |
Sample Type Confirmation |
NOMO1 is strongly supported by BioGPS gene expression data to be expressed in MCF7 |
Protein Accession # |
NP_055102 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_014287 |
Tested Species Reactivity |
Human |
Gene Symbol |
NOMO1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB, IHC |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
Image 1 | Human MCF7
| WB Suggested Anti-NOMO1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: MCF7 cell lysateNOMO1 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells |
|
Image 2 | Human Pineal Tissue
| NOMO1 antibody - C-terminal region (ARP54998_P050)
Catalog Number: ARP54998_P050
Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
Observed Staining: Cytoplasm in Human Pineal Tissue
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|