NOMO1 Antibody - N-terminal region (ARP54997_P050)

Data Sheet
 
Product Number ARP54997_P050
Product Page www.avivasysbio.com/nomo1-antibody-n-terminal-region-arp54997-p050.html
Name NOMO1 Antibody - N-terminal region (ARP54997_P050)
Protein Size (# AA) 1222 amino acids
Molecular Weight 134kDa
NCBI Gene Id 23420
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name NODAL modulator 1
Alias Symbols PM5, Nomo
Peptide Sequence Synthetic peptide located within the following region: DGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lim,J., (2006) Cell 125 (4), 801-814
Description of Target NOMO1 was originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE). This gene encodes a protein originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE).
Protein Interactions UBC; TRIM63; TRIM55; EXOSC10; FBXO6; UPF2; STAT1; ECT2; TIMM10; PLEC; ILF3; UBQLN4; SHBG; CDK2; TOM1L1; BAG6; NCLN;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NOMO1 (ARP54997_P050) antibody
Blocking Peptide For anti-NOMO1 (ARP54997_P050) antibody is Catalog # AAP54997 (Previous Catalog # AAPP32258)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NOMO1
Uniprot ID P69849
Protein Name Nodal modulator 3
Sample Type Confirmation

NOMO1 is supported by BioGPS gene expression data to be expressed in HeLa

Protein Accession # NP_055102
Purification Affinity Purified
Nucleotide Accession # NM_014287
Tested Species Reactivity Human
Gene Symbol NOMO1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human HeLa
WB Suggested Anti-NOMO1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysateNOMO1 is supported by BioGPS gene expression data to be expressed in HeLa
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com