METTL5 Antibody - N-terminal region (ARP54981_P050)

Data Sheet
 
Product Number ARP54981_P050
Product Page www.avivasysbio.com/mettl5-antibody-n-terminal-region-arp54981-p050.html
Name METTL5 Antibody - N-terminal region (ARP54981_P050)
Protein Size (# AA) 209 amino acids
Molecular Weight 24kDa
NCBI Gene Id 29081
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Methyltransferase like 5
Alias Symbols MRT72, HSPC133
Peptide Sequence Synthetic peptide located within the following region: KKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hillier,L.W., (2005) Nature 434 (7034), 724-731
Description of Target METTL5 is a probable methyltransferase.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-METTL5 (ARP54981_P050) antibody
Blocking Peptide For anti-METTL5 (ARP54981_P050) antibody is Catalog # AAP54981 (Previous Catalog # AAPP32142)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human METTL5
Uniprot ID Q9NRN9
Protein Name Methyltransferase-like protein 5
Sample Type Confirmation

METTL5 is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_054887
Purification Affinity Purified
Nucleotide Accession # NM_014168
Tested Species Reactivity Human
Gene Symbol METTL5
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Image 1
Human HepG2
WB Suggested Anti-METTL5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysateMETTL5 is supported by BioGPS gene expression data to be expressed in HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com