PYCR2 Antibody - C-terminal region (ARP54938_P050)

• Product Number: ARP54938_P050
• Name: PYCR2 Antibody - C-terminal region (ARP54938_P050)
• Protein Size (# AA): 320 amino acids
• Molecular Weight: 34 kDa
• NCBI Gene Id: 29920
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Pyrroline-5-carboxylate reductase family, member 2
• Alias Symbols: HLD10, P5CR2
• Peptide Sequence: Synthetic peptide located within the following region: LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Lim,J., (2006) Cell 125 (4), 801-814
• Description of Target: PYCR2 belongs to the pyrroline-5-carboxylate reductase family. The function of the PYCR2 protein is not known.
• Protein Interactions: SUMO2; UBC; MDM2; VCAM1; SKIL; MDC1; APP; CIC; KCND3; CUL3; EBNA-LP; ICT1; TERF2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-PYCR2 (ARP54938_P050) antibody is Catalog # AAP54938 (Previous Catalog # AAPP31893)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PYCR2
• Uniprot ID: Q96C36
• Protein Name: Pyrroline-5-carboxylate reductase 2
• Protein Accession #: NP_037460
• Purification: Affinity Purified
• Nucleotide Accession #: NM_013328
• Tested Species Reactivity: Human
• Gene Symbol: PYCR2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Image 1:
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.8 ug/mL of the antibody was used in this experiment.