Product Number |
ARP54937_P050 |
Product Page |
www.avivasysbio.com/pycr2-antibody-middle-region-arp54937-p050.html |
Name |
PYCR2 Antibody - middle region (ARP54937_P050) |
Protein Size (# AA) |
320 amino acids |
Molecular Weight |
34kDa |
NCBI Gene Id |
29920 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Pyrroline-5-carboxylate reductase family, member 2 |
Alias Symbols |
HLD10, P5CR2 |
Peptide Sequence |
Synthetic peptide located within the following region: LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Lim,J., (2006) Cell 125 (4), 801-814 |
Description of Target |
PYCR2 belongs to the pyrroline-5-carboxylate reductase family. The function of the PYCR2 protein is not known. |
Protein Interactions |
SUMO2; UBC; MDM2; VCAM1; SKIL; MDC1; APP; CIC; KCND3; CUL3; EBNA-LP; ICT1; TERF2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PYCR2 (ARP54937_P050) antibody |
Other Applications Image 1 Data |
WB Suggested Anti-PYCR2 antibody Titration: 3.3 ug/ml Positive Control: Human fibroblast
|
Blocking Peptide |
For anti-PYCR2 (ARP54937_P050) antibody is Catalog # AAP54937 (Previous Catalog # AAPP31892) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PYCR2 |
Uniprot ID |
Q96C36 |
Protein Name |
Pyrroline-5-carboxylate reductase 2 |
Protein Accession # |
NP_037460 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_013328 |
Tested Species Reactivity |
Human |
Gene Symbol |
PYCR2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IHC, WB, IP |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-PYCR2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:12500 Positive Control: HepG2 cell lysate |
|
Image 2 | Human
| PYCR2 antibody - middle region (ARP54937_P050) validated by WB using 293T cells lysate at 1 ug/ml. |
|
Image 3 | Human fibroblast
| Lanes: 1. 10 ug human fibroblast lysate 2. 10 ug PYCR1 KO human fibroblast lysate Primary Antibody Dilution: 1:300 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:1000 Gene Name: PYCR2 Submitted by: Anonymous
|
|
Image 4 | human fibroblast
| Sample Type: 1. WT human fibroblast 2. PYCR1 KO human fibroblastPrimary Antibody Dilution: 1:250Secondary Antibody: Anti-rabbit AlexaFluor 488Secondary Antibody Dilution: 1:1000Color/Signal Descriptions: PYCR2: Green DAPI:BlueGene Name: PYCR2 Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science |
|