PADI4 Antibody - middle region (ARP54888_P050)

Data Sheet
 
Product Number ARP54888_P050
Product Page www.avivasysbio.com/padi4-antibody-middle-region-arp54888-p050.html
Name PADI4 Antibody - middle region (ARP54888_P050)
Protein Size (# AA) 663 amino acids
Molecular Weight 74 kDa
NCBI Gene Id 23569
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Peptidyl arginine deiminase, type IV
Alias Symbols PAD, PAD4, PDI4, PDI5, PADI5
Peptide Sequence Synthetic peptide located within the following region: TGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQAL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Costenbader,K.H., (er) Arthritis Res. Ther. 10 (3), R52 (2008) In press
Description of Target PADI4 is an enzyme responsible for the conversion of arginine residues to citrulline residues. This protein may play a role in granulocyte and macrophage development leading to inflammation and immune response.This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions ANXA4; FBXO25; APP; ING4; ELK1; NPM1; TP53; HDAC2; HIST2H3A; HDAC1; TFF1; HIST4H4; HIST3H3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-PADI4 (ARP54888_P050) antibody
Blocking Peptide For anti-PADI4 (ARP54888_P050) antibody is Catalog # AAP54888 (Previous Catalog # AAPP31690)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PADI4
Uniprot ID Q9UM07
Protein Name Protein-arginine deiminase type-4
Sample Type Confirmation

There is BioGPS gene expression data showing that PADI4 is expressed in 721_B

Protein Accession # NP_036519
Purification Affinity Purified
Nucleotide Accession # NM_012387
Tested Species Reactivity Human
Gene Symbol PADI4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 87%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 86%; Rat: 100%; Sheep: 79%; Zebrafish: 86%
Image 1
Human HCT116 Whole Cell
Host: Rabbit
Target Name: PADI4
Sample Tissue: Human HCT116 Whole Cell
Antibody Dilution: 1ug/ml
Image 2
Western Blot
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. An isoform containing the peptide sequence is present at ~66 kDa.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com