CDC42EP4 Antibody - N-terminal region (ARP54839_P050)

Data Sheet
 
Product Number ARP54839_P050
Product Page www.avivasysbio.com/cdc42ep4-antibody-n-terminal-region-arp54839-p050.html
Name CDC42EP4 Antibody - N-terminal region (ARP54839_P050)
Protein Size (# AA) 356 amino acids
Molecular Weight 38 kDa
NCBI Gene Id 23580
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name CDC42 effector protein (Rho GTPase binding) 4
Alias Symbols CEP4, BORG4, KAIA1777
Peptide Sequence Synthetic peptide located within the following region: SSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Olsen,J.V., (2006) Cell 127 (3), 635-648
Description of Target CDC42EP4 is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. The protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, the protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control.The product of this gene is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. This protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, this protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control.
Protein Interactions FAM9B; SRPK2; UBC; VCP; APP; LNX1; ELAVL1; CDC42; POLR3H; WDR6; RHOQ; TGFBR1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CDC42EP4 (ARP54839_P050) antibody
Blocking Peptide For anti-CDC42EP4 (ARP54839_P050) antibody is Catalog # AAP54839 (Previous Catalog # AAPP31643)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CDC42EP4
Uniprot ID Q9H3Q1
Protein Name Cdc42 effector protein 4
Sample Type Confirmation

CDC42EP4 is strongly supported by BioGPS gene expression data to be expressed in HeLa

There is BioGPS gene expression data showing that CDC42EP4 is expressed in 721_B

Protein Accession # NP_036253
Purification Affinity Purified
Nucleotide Accession # NM_012121
Tested Species Reactivity Human
Gene Symbol CDC42EP4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The protein may be modified by phosphorylation.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com