| Product Number |
ARP54830_P050 |
| Product Page |
www.avivasysbio.com/ak1-antibody-middle-region-arp54830-p050.html |
| Name |
Ak1 Antibody - middle region (ARP54830_P050) |
| Protein Size (# AA) |
194 amino acids |
| Molecular Weight |
21kDa |
| NCBI Gene Id |
24183 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
Ak 1 |
| Peptide Sequence |
Synthetic peptide located within the following region: TVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFERKIAQPTLLLYVDA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Ak1 catalyzes the conversion of ATP and AMP to ADP in adenine nucleotide metabolism. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Ak1 (ARP54830_P050) antibody |
| Blocking Peptide |
For anti-Ak1 (ARP54830_P050) antibody is Catalog # AAP54830 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Rat Ak1 |
| Uniprot ID |
P39069 |
| Protein Name |
Adenylate kinase isoenzyme 1 |
| Protein Accession # |
NP_077325 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_024349 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Ak1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 86%; Zebrafish: 100% |
| Image 1 | Rat Testis
 | Host: Rabbit
Target Name: Ak1
Sample Type: Rat Testis lysates
Antibody Dilution: 1.0ug/ml |
|
|
